Skip to Content

ELISA Recombinant Mouse Arylacetamide deacetylase-like 3(Aadacl3)

https://www.afigen.com/web/image/product.template/143828/image_1920?unique=2109108
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:A2A7Z8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVVLALTLLVGSVAVFSLGSLLWVVGKHFWTEHIPEGITHPWRLRILSCLFHLTMTWGMI FEKLGLCYAPQFASFLHDLKPLKRDPDVVVKDLHFGTIPVKLYKPKKPSSIPRLGIIFFH GGGTIIGSLRTHNSICLRLSKECDSVVVSVGYRKSPMYKYPVMKDDCVVATTHFLESLDV YGVDPARVVTCGDSVGGTAATVTSQmLVHRPDLPRIKAQILIYPLLQLIDFGSPSYQQNR NIPLLSWDLAFYCFCCHLDVNISWKSVVKNGMHLPPDVWEKYRKWLGAENIPERFKNRGY KSIPWGPVNNDAYQEIKRSLNYTCSPLISEDSIVSQLPETCIVSCEYDLLRDHSLLYKKR LEDLGVPVTWHHMEDGFHGVLSALDYGLLSFPCASRIMDLIIQFIRKF Protein Names:Recommended name: Arylacetamide deacetylase-like 3 EC= 3.1.1.- Gene Names:Name:Aadacl3 Expression Region:1-408 Sequence Info:FµLl length protein

1,766.00 € 1766.0 EUR 1,766.00 €

1,766.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days