ELISA Recombinant Pongo abelii Brain protein 44(BRP44)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R4Z3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAAGARGLRATYHRLLDKVELmLPEKLRPLYNHPAGPRTVFFWAPIMKRGLVCAGLADM ARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQE LKAKAHK Protein Names:Recommended name: Brain protein 44 Gene Names:Name:BRP44 Expression Region:1-127 Sequence Info:fµLl length protein