ELISA Recombinant Mouse Protein Q300(Hpvc2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q02722 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKCHHAHLQFHFYKFWWEGETNLFYVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAI HCGVFVCVLIFEPGLTM Protein Names:Recommended name: Protein Q300 Gene Names:Name:Hpvc2 Synonyms:Q300 Expression Region:1-77 Sequence Info:fµLl length protein