ELISA Recombinant Murine coronavirus Envelope small membrane protein(E)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Murine coronavirus (strain S) (MHV-S) (Murine hepatitis virus) Uniprot NO.:P29076 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFNLFLTDTVWYVGQIIFIVAVCLMVTITVVAFLASIKLCIQLCGLCNTLVLSPSIYLYD RSKQLYKYYNEEVRPPPLEVDDIIIQTL Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Gene Names:Name:E Synonyms:sM ORF Names:5b Expression Region:1-88 Sequence Info:fµLl length protein