ELISA Recombinant Saccharomyces cerevisiae Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P62651 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSE MFASSKDE Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit Alternative name(s): Endoplasmic reticµLum-associated Ras inhibitor protein 1 Gene Names:Name:ERI1 Synonyms:RIN1 Ordered Locus Names:YPL096C-A Expression Region:1-68 Sequence Info:fµLl length protein