ELISA Recombinant Heliothis virescens ascovirus 3e Uncharacterized protein ORF18 (ORF18)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Heliothis virescens ascovirus 3e (HvAV-3e) Uniprot NO.:A4KX73 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTNVVIDTKPVWGNmLPQLKWKDGTVVISEDDKHNEPYGIGKFFNFKEDFTRLYFKAIVN NPRERKTIEALISLPRSVADVCNPGGVYLGGRTLVDNVAKKFATIKASVDANGKVGYDTS DLERLGVRCRYYVDDLVKDDALMRRILLENKWKSKYPALVKPYEEYQRSKPKTIVLPTNR NNPVRSNVDIKPVNPPSSKVVKTVETDERLKDPPHTGALKTLIPLQKPIAPVQISEKPVV VKPEIKSPSKVIQTPDPQTVVAGKIIPNNESADSRSLFGSPVLLICVASLLLLIIIL Protein Names:Recommended name: Uncharacterized protein ORF18 Gene Names:ORF Names:ORF18 Expression Region:1-297 Sequence Info:fµLl length protein