ELISA Recombinant Cronobacter sakazakii Spermidine export protein MdtI(mdtI)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii) Uniprot NO.:A7MEJ5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQVELQHILWLLLAIGLEIIANIWLKFSDGFRRPVYGVASLAAVLAAFSALGQAVEGID LAVAYALWGGFGIAATVAAGWIMFGQRLNRKGWAGLGLLLVGMVIIKLA Protein Names:Recommended name: Spermidine export protein MdtI Gene Names:Name:mdtI Ordered Locus Names:ESA_01730 Expression Region:1-109 Sequence Info:fµLl length protein