ELISA Recombinant Malassezia globosa Assembly factor CBP4(CBP4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) Uniprot NO.:A8PYF7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA processing protein 4 Gene Names:Name:CBP4 ORF Names:MGL_1653 Expression Region:1-73 Sequence Info:fµLl length protein