ELISA Recombinant Lolium perenne ATP synthase subunit c, chloroplastic(atpH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Lolium perenne (Perennial ryegrass) Uniprot NO.:A8Y9G5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names:Name:atpH Ordered Locus Names:LopeCp028 Expression Region:1-81 Sequence Info:fµLl length protein