ELISA Recombinant Nostoc punctiforme NAD(P)H-quinone oxidoreductase subunit L

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Nostoc punctiforme (strain ATCC 29133 / PCC 73102) Uniprot NO.:B2J0I9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVALLYLILAGAYLLVIPIAVLFYLKQRWYVASSIERLLMYFLVFFFFPGLLVLSPFAN FRPQRRQVQV Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L Gene Names:Name:ndhL Ordered Locus Names:Npun_F6621 Expression Region:1-70 Sequence Info:fµLl length protein