ELISA Recombinant Clavispora lusitaniae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)
Uniprot NO.:C4YBX9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVIGAPKGHNRYRDPKTFQMTPALYRVRKPFFWKNFAGFFLVSSIPLGVYLYTWNVLSK DEFADIPIPPISDEELAKLKKEYESK
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 ORF Names:CLµg_05707
Expression Region:1-86
Sequence Info:fµLl length protein