ELISA Recombinant Clavispora lusitaniae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae) Uniprot NO.:C4YBX9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVIGAPKGHNRYRDPKTFQMTPALYRVRKPFFWKNFAGFFLVSSIPLGVYLYTWNVLSK DEFADIPIPPISDEELAKLKKEYESK Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Gene Names:Name:COA3 ORF Names:CLµg_05707 Expression Region:1-86 Sequence Info:fµLl length protein