Skip to Content

ELISA Recombinant Serpentine receptor class delta-48(srd-48)

https://www.afigen.com/web/image/product.template/114389/image_1920?unique=263afdf
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis elegans Uniprot NO.:O17822 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYGEILSFFYITFFILVLPTQIFGIFVILRFSTKHLKLWKKFLLCNLICQIISVATLCLL QLRQVSNLSPMEIWCYGPIRHFSAITSYLFYVLSQISTLMTYFLVFITIYLKYEAVKNVN KQNYRKVVIILmLLLPIFITMVAQIDLMIVFFSPNEAQKKFNELNAIITDHSVIGYVISG RISSFLLTVIIFGSVFLLPPAGFFIRKKIIRCINSTSDSASVGQKFQRRSFINGLTLQSF LPLVCICPIFACYFVVSRTKTDLPFEQHILPVLVmLPTLFDPYIILYSVTPYRKQIRTWL GMTKTVPMVIVASVMI Protein Names:Recommended name: Serpentine receptor class delta-48 Short name= Protein srd-48 Gene Names:Name:srd-48 ORF Names:F17A2.9 Expression Region:1-316 Sequence Info:fµLl length protein

1,669.00 € 1669.0 EUR 1,669.00 €

1,669.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days