ELISA Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopZ(yopZ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:O34509 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSEMQLQAQIDVIEKENKELRRRNEELGQTVECQNKQIVTQNWRLLFFASSWIVYGIVS AIKYLWG Protein Names:Recommended name: SPBc2 prophage-derived uncharacterized protein yopZ Gene Names:Name:yopZ Ordered Locus Names:BSU20710 Expression Region:1-67 Sequence Info:fµLl length protein