ELISA Recombinant Arabidopsis thaliana Probable cytochrome c oxidase subunit 5C-1 (At2g47380)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:O22912 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGHKVAHATLKGPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVV AAEE Protein Names:Recommended name: Probable cytochrome c oxidase subunit 5C-1 Alternative name(s): Cytochrome c oxidase polypeptide Vc-1 Gene Names:Ordered Locus Names:At2g47380 ORF Names:T8I13.22 Expression Region:1-64 Sequence Info:fµLl length protein