ELISA Recombinant Bacillus subtilis Uncharacterized protein yfkS(yfkS)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O35036
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISYIVQTLIVCIAIYAYEWKNFRSANNLTKWAFSLLIAGSAFLWIYMRVNPLLPRLGHL FKYIPF
Protein Names:Recommended name: Uncharacterized protein yfkS
Gene Names:Name:yfkS Ordered Locus Names:BSU07770
Expression Region:1-66
Sequence Info:fµLl length protein