Skip to Content

ELISA Recombinant Xenopus tropicalis Protein FAM134C(fam134c)

https://www.afigen.com/web/image/product.template/161541/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q0P4Z1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQRVGEEEQGASGLRRRRSGARCVEARERDEQVREVQEmLQRGLSSYEPVLSYVQAVLV WERPRHSALLHLALNAAFWFFALTSLRIIFLVAFGLMIIICADQWKNKLWPELGAARASE LENESWGYVHPRLLSVPELCYHAADTWVSVYNFLRNLLLFKTENPGKFCLLACSFLTFLA VLGGYIPGVVLSYLLLLFLLLWPLAIYHQLGRRIYQKLEPALQRLDFSVRGYMMSKYKER QKHNRALPPTDASDSEEELAAFCPSLDDSAVAKELTISDSEHSDAEVSFTENGTFNLSRG QTPLTEGSEDLDRHSDPEESFARDLPDFPSINPDATGIEDDDETSIGIPSTALHPQFSSR QLYEEQESLDAELSLGGFPSTQNITENIAGFVTRGMIQLALAGASQQTHAYAESPRAKQY QRNSSSELDTDAEADDFELLDQSELSQMDPSSSHSHQ Protein Names:Recommended name: Protein FAM134C Gene Names:Name:fam134c ORF Names:TNeu105l15.1 Expression Region:1-457 Sequence Info:fµLl length protein

1,817.00 € 1817.0 EUR 1,817.00 €

1,817.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days