Skip to Content

ELISA Recombinant Haloquadratum walsbyi Putative metal transport protein HQ3622A(HQ3622A)

https://www.afigen.com/web/image/product.template/128649/image_1920?unique=4552294
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haloquadratum walsbyi (strain DSM 16790) Uniprot NO.:Q18EC3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASIVGYAEPLENAAKMTGATDAAMNLNPGVLPDYTVGGFSGPIGTLISAGVGTVLTLIVA FGAGRLLES Protein Names:Recommended name: Putative metal transport protein HQ3622A Gene Names:Ordered Locus Names:HQ3622A Expression Region:33-101 Sequence Info:fµLl length protein

1,408.00 € 1408.0 EUR 1,408.00 €

1,408.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days