ELISA Recombinant Heme transporter hrg-1(hrg-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis elegans Uniprot NO.:Q21642 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHQIYSSDVSSITSKSSIAKAEIITMEEEQQRQSCCTWFHSLKVQIWIAWLGVSAGVMAG TVFAIQYQNWIAVTMCFISSGFATLVLHLHLAYKKTQMAGWSETRLRCLAAVGATVSFLS FIAMVFCLVVAGIEHQTLDKQGLMGANLWIAAVWFFMTSKWSALTWRFARKYRAFCEESQ PLLAAAPPEYSVTI Protein Names:Recommended name: Heme transporter hrg-1 Alternative name(s): Heme-responsive gene 1 protein Short name= CeHRG-1 Gene Names:Name:hrg-1 ORF Names:R02E12.6 Expression Region:1-194 Sequence Info:fµLl length protein