ELISA Recombinant Pan paniscus Taste receptor type 2 member 66(TAS2R66)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pan paniscus (Pygmy chimpanzee) (Bonobo) Uniprot NO.:Q5Y4Y8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVPRVGLLW VLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLR LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT ILANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQPFLSVLWQMRYW VKGEKPSSS Protein Names:Recommended name: Taste receptor type 2 member 66 Short name= T2R66 Gene Names:Name:TAS2R66 Expression Region:1-309 Sequence Info:fµLl length protein