Skip to Content

ELISA Recombinant Influenza A virus Matrix protein 2(M)

https://www.afigen.com/web/image/product.template/141117/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Influenza A virus (strain A/Shearwater/Australia/1972 H6N5) Uniprot NO.:Q67146 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLLTEVETPTRNGWECKYSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE Protein Names:Recommended name: Matrix protein 2 Alternative name(s): Proton channel protein M2 Gene Names:Name:M Expression Region:1-97 Sequence Info:fµLl length protein

1,437.00 € 1437.0 EUR 1,437.00 €

1,437.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days