ELISA Recombinant Ashbya gossypii ATP synthase subunit 9, mitochondrial(ATP9)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q75G38
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKDTLFQFAILGFAISEA TGLFCLMISFLLLYGV
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:ATP9 Ordered Locus Names:AMI007W ORF Names:AgATP9
Expression Region:1-76
Sequence Info:fµLl length protein