Skip to Content

ELISA Recombinant Mouse Probable G-protein coupled receptor 151 protein(Gpr151)

https://www.afigen.com/web/image/product.template/145717/image_1920?unique=c91b609
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q7TSN6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKAmLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPSLLMAVCLVGLVGNLC VIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYSKGVWDLGWFICKSSDW FTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLAGIWVVASLLPLPEWLFS TTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLAGVYFWRAYDQCKTRCTKT RNLRDQMRSKQLTVmLLSTAIISALLWLPEWIAWLWVWHVKAGGPMPPQGFIALSQVLMF FTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQEAPAGNTEALPGKAPSPETQ TCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDAVPSAQDNDPIPWEHEGQETEG CN Protein Names:Recommended name: Probable G-protein coupled receptor 151 protein Alternative name(s): G-protein coupled receptor PGR7 GPCR-2037 Gene Names:Name:Gpr151 Synonyms:Pgr7 Expression Region:1-422 Sequence Info:fµLl length protein

1,780.00 € 1780.0 EUR 1,780.00 €

1,780.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days