Skip to Content

ELISA Recombinant Mouse ATP-sensitive inward rectifier potassium channel 10(Kcnj10)

https://www.afigen.com/web/image/product.template/143864/image_1920?unique=2109108
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q9JM63 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES LREQAEKEGSALSVRISNV Protein Names:Recommended name: ATP-sensitive inward rectifier potassium channel 10 Alternative name(s): Inward rectifier K(+) channel Kir4.1 Potassium channel, inwardly rectifying subfamily J member 10 Gene Names:Name:Kcnj10 Expression Region:1-379 Sequence Info:fµLl length protein

1,735.00 € 1735.0 EUR 1,735.00 €

1,735.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days